(data stored in ACNUC7421 zone)

EMBL: CP001349.PE157

CP001349.PE157       Location/Qualifiers
FT   CDS             complement(175600..177009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0163"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: rle:pRL110185 putative transmembrane adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55209"
FT                   /db_xref="GOA:B8IUG4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG4"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55209.1"
FT                   /translation="MTGAISLGRLLAELGTLRAVDASGRMRRVLRQQEDAGLAFAFRAR
FT                   QAAILVVSLWLLFLVPTPRDLYYLAFAALFFGLGWIPFRLRRHRRALAIKLGFILLDAV
FT                   LVTLVVVLPPPAELGVDWPIQTRLRAVEYLYLLLLLGEASLSYSPLAVVWTGFSIMGAW
FT                   SVAVVAVYCRPDTVRYRDVVAQLGPLSDEMALKTVFDPRYVGLTPWWTQMVLTALLTSL
FT                   LACAVARARATLLARVRGEVARADLARYVSPDVADALTATAHSGFGAPRERVVAVLFAD
FT                   LVGFTTLAERLQPETVLALLKAFRERSCRIVFAHGGTLDKFLGDGFMATFGCLEDEPDA
FT                   PHTALACALALQEEMARWNAEREAAGQPCVALSIGLHCGPVVVGTIGAQQRVEFTVVGD
FT                   VVNVASRLQQATRDLGGGIVASEGCLAAAIDAGLALDGFGDSRELTLRGRSQPIRVRVW
FT                   TGHPPTVPRPA"
     MTGAISLGRL LAELGTLRAV DASGRMRRVL RQQEDAGLAF AFRARQAAIL VVSLWLLFLV        60
     PTPRDLYYLA FAALFFGLGW IPFRLRRHRR ALAIKLGFIL LDAVLVTLVV VLPPPAELGV       120
     DWPIQTRLRA VEYLYLLLLL GEASLSYSPL AVVWTGFSIM GAWSVAVVAV YCRPDTVRYR       180
     DVVAQLGPLS DEMALKTVFD PRYVGLTPWW TQMVLTALLT SLLACAVARA RATLLARVRG       240
     EVARADLARY VSPDVADALT ATAHSGFGAP RERVVAVLFA DLVGFTTLAE RLQPETVLAL       300
     LKAFRERSCR IVFAHGGTLD KFLGDGFMAT FGCLEDEPDA PHTALACALA LQEEMARWNA       360
     EREAAGQPCV ALSIGLHCGP VVVGTIGAQQ RVEFTVVGDV VNVASRLQQA TRDLGGGIVA       420
     SEGCLAAAID AGLALDGFGD SRELTLRGRS QPIRVRVWTG HPPTVPRPA                   469
//

If you have problems or comments...

PBIL Back to PBIL home page