(data stored in ACNUC7421 zone)

EMBL: CP001349.PE158

CP001349.PE158       Location/Qualifiers
FT   CDS             complement(177163..177399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55210"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG5"
FT                   /inference="similar to AA sequence:KEGG:M446_4595"
FT                   /protein_id="ACL55210.1"
FT                   /translation="MTHLYFHCGHSGELLLDYRGADVTDLKEARDRALAVARSVMETAY
FT                   GHQDFSDWFVCVGDEDDEELMRVPFTSALPTLH"
     MTHLYFHCGH SGELLLDYRG ADVTDLKEAR DRALAVARSV METAYGHQDF SDWFVCVGDE        60
     DDEELMRVPF TSALPTLH                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page