(data stored in ACNUC7421 zone)

EMBL: CP001349.PE159

CP001349.PE159       Location/Qualifiers
FT   CDS             complement(177547..177852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55211"
FT                   /db_xref="GOA:B8IUG6"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG6"
FT                   /inference="similar to AA sequence:KEGG:M446_4594"
FT                   /protein_id="ACL55211.1"
FT                   /translation="MNPTAEAWDARVDRLTERLPERGQRWLAWLRAPSRRWIRIPAAFL
FT                   LVLGGFLSILPVLGLWMLPLGLALLSEDWPVLKVPLEHAARGIERLWRKVFPDRTA"
     MNPTAEAWDA RVDRLTERLP ERGQRWLAWL RAPSRRWIRI PAAFLLVLGG FLSILPVLGL        60
     WMLPLGLALL SEDWPVLKVP LEHAARGIER LWRKVFPDRT A                           101
//

If you have problems or comments...

PBIL Back to PBIL home page