(data stored in ACNUC7421 zone)

EMBL: CP001349.PE16

CP001349.PE16        Location/Qualifiers
FT   CDS             18830..19576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0017"
FT                   /product="Extensin family protein"
FT                   /note="PFAM: Extensin family protein; KEGG: met:M446_0012
FT                   extensin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55068"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT06"
FT                   /inference="protein motif:PFAM:PF06904"
FT                   /protein_id="ACL55068.1"
FT                   /translation="MLIRHPVLLAALLLARPAVAEVPLPPPRPDRPPPAAEPAPSPLEP
FT                   APTPAPLPPERPAELPAGPVTPVVPDDTACLRRLDRLGVKAEPLPPLSDGLCGAPKPLR
FT                   VTELPDGVLVSPAATLTCQATEALARWSTEVRVLAERGLGYAPRSVRIATSYECRGQNR
FT                   DPEAKLSEHAFANAVDIVGFTFEGRDPVTIGTEADGTPEAAFQAAVQAKACAFFRTVLG
FT                   PGSDAAHGNHLHLDERERPAGHRLCQ"
     MLIRHPVLLA ALLLARPAVA EVPLPPPRPD RPPPAAEPAP SPLEPAPTPA PLPPERPAEL        60
     PAGPVTPVVP DDTACLRRLD RLGVKAEPLP PLSDGLCGAP KPLRVTELPD GVLVSPAATL       120
     TCQATEALAR WSTEVRVLAE RGLGYAPRSV RIATSYECRG QNRDPEAKLS EHAFANAVDI       180
     VGFTFEGRDP VTIGTEADGT PEAAFQAAVQ AKACAFFRTV LGPGSDAAHG NHLHLDERER       240
     PAGHRLCQ                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page