(data stored in ACNUC7421 zone)

EMBL: CP001349.PE160

CP001349.PE160       Location/Qualifiers
FT   CDS             177952..179169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0166"
FT                   /product="protein of unknown function DUF482"
FT                   /note="PFAM: protein of unknown function DUF482; KEGG:
FT                   met:M446_4593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55212"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG7"
FT                   /inference="protein motif:PFAM:PF04339"
FT                   /protein_id="ACL55212.1"
FT                   /translation="MESGGQAASGPASPDALTVRVVPRIAEIPAAEWDRCALSRESLAG
FT                   TGESHNPFVTHAFLSALEEAGCVSGRAGWLPLHLAVERAGRLVGVAPCYLKSHSRGEYV
FT                   FDHGWADAYARAGGDYYPKLQVSVPFTPVTGPRLLLAPGEPAEEAIAALIAGLRALRRE
FT                   TKASSIHVTFMPEAQWAAAGRLGFLQRVDQQFHWDNQGYGSFEAFLGALASRKRKAVKR
FT                   ERRDALASGVTVEWVTGSDLTEAHWDAFFRFYMDTGSRKWGRPYLNRRFFSLLGERMPE
FT                   RVLLVMARRQGRYVAGALNLIGDTALYGRNWGCIEDHPFLHFEVCYYQAIDFAIARGLA
FT                   RVEAGAQGEHKLARGYRPVVTHSAHDIADPGLRAAIADYLRREAGYVRQALCEYEASTP
FT                   YRQGEE"
     MESGGQAASG PASPDALTVR VVPRIAEIPA AEWDRCALSR ESLAGTGESH NPFVTHAFLS        60
     ALEEAGCVSG RAGWLPLHLA VERAGRLVGV APCYLKSHSR GEYVFDHGWA DAYARAGGDY       120
     YPKLQVSVPF TPVTGPRLLL APGEPAEEAI AALIAGLRAL RRETKASSIH VTFMPEAQWA       180
     AAGRLGFLQR VDQQFHWDNQ GYGSFEAFLG ALASRKRKAV KRERRDALAS GVTVEWVTGS       240
     DLTEAHWDAF FRFYMDTGSR KWGRPYLNRR FFSLLGERMP ERVLLVMARR QGRYVAGALN       300
     LIGDTALYGR NWGCIEDHPF LHFEVCYYQA IDFAIARGLA RVEAGAQGEH KLARGYRPVV       360
     THSAHDIADP GLRAAIADYL RREAGYVRQA LCEYEASTPY RQGEE                       405
//

If you have problems or comments...

PBIL Back to PBIL home page