(data stored in ACNUC7421 zone)

EMBL: CP001349.PE161

CP001349.PE161       Location/Qualifiers
FT   CDS             179441..180400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55213"
FT                   /db_xref="GOA:B8IUG8"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG8"
FT                   /inference="similar to AA sequence:KEGG:M446_4592"
FT                   /protein_id="ACL55213.1"
FT                   /translation="MAEAERARLEPMTVSSAPSVGLAAVILAATQDEPRVLTVPVPDQP
FT                   PGRGEGLPSGPLEPAHPTLERGLRAWVERQTGQTLGYVEQLYTFGDRNRRPGGDGQHAL
FT                   SVAYLALAREARPTADSAWQNWYRYFPYEDWRTGRPGSLDAIAARLDAWARAAPDSGER
FT                   RRRLDRIGLTFGVAGGGWNEERVLERYELLFEAGLVPEAGAPDPLAGQPMALDHRRMLA
FT                   TALGRLRGKIKYRPVVFELMPPTFTLGQLQRVVEALSGVLLHKQNFRRLVAQQGLVEET
FT                   DAISAETGGRPARLMRFRREVLLERPAPGVRLPPGRRL"
     MAEAERARLE PMTVSSAPSV GLAAVILAAT QDEPRVLTVP VPDQPPGRGE GLPSGPLEPA        60
     HPTLERGLRA WVERQTGQTL GYVEQLYTFG DRNRRPGGDG QHALSVAYLA LAREARPTAD       120
     SAWQNWYRYF PYEDWRTGRP GSLDAIAARL DAWARAAPDS GERRRRLDRI GLTFGVAGGG       180
     WNEERVLERY ELLFEAGLVP EAGAPDPLAG QPMALDHRRM LATALGRLRG KIKYRPVVFE       240
     LMPPTFTLGQ LQRVVEALSG VLLHKQNFRR LVAQQGLVEE TDAISAETGG RPARLMRFRR       300
     EVLLERPAPG VRLPPGRRL                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page