(data stored in ACNUC7421 zone)

EMBL: CP001349.PE162

CP001349.PE162       Location/Qualifiers
FT   CDS             181196..182197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0168"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: met:M446_4591
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55214"
FT                   /db_xref="GOA:B8IUG9"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG9"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ACL55214.1"
FT                   /translation="MAAVTQAVQEALPLPDLYARVKGHVPAIEWPALAEDVAAIQMLKR
FT                   QRNAVVLAHNYQAPEIFHTVADIVGDSLALAREAARTDADVIVLAGVHFMAETAKLLNP
FT                   EKTVLIPDQAAGCSLADSITAADVRALRRSHPGVPIVTYVNTSAAVKAESDLCCTSGNA
FT                   KAVVESLGVPRVLMIPDEYLARNVQAELPQVEILSWAGHCEVHERFSPADIREVREAYP
FT                   GVTVLAHPECPPEVVAEADFAGSTAAMQDFVETRRPAQVVMITECSMADNLAVRNPEVA
FT                   FVKPCNLCPHMKRISLSKIRRALETMTHEVTVPSDLIAPARRAVERMLAVRP"
     MAAVTQAVQE ALPLPDLYAR VKGHVPAIEW PALAEDVAAI QMLKRQRNAV VLAHNYQAPE        60
     IFHTVADIVG DSLALAREAA RTDADVIVLA GVHFMAETAK LLNPEKTVLI PDQAAGCSLA       120
     DSITAADVRA LRRSHPGVPI VTYVNTSAAV KAESDLCCTS GNAKAVVESL GVPRVLMIPD       180
     EYLARNVQAE LPQVEILSWA GHCEVHERFS PADIREVREA YPGVTVLAHP ECPPEVVAEA       240
     DFAGSTAAMQ DFVETRRPAQ VVMITECSMA DNLAVRNPEV AFVKPCNLCP HMKRISLSKI       300
     RRALETMTHE VTVPSDLIAP ARRAVERMLA VRP                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page