(data stored in ACNUC7421 zone)

EMBL: CP001349.PE163

CP001349.PE163       Location/Qualifiers
FT   CDS             182194..183693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0169"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /EC_number="1.4.3.16"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: met:M446_4590
FT                   L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55215"
FT                   /db_xref="GOA:B8IUH0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUH0"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACL55215.1"
FT                   /translation="MSADRTLVVGAGVAGLATALRLAPLPVTLLTGAPLGEGTATAWAQ
FT                   GGIAAAIGPDDDPALHAADTRAAGAGLTDPDVAQRVAEAGPGLVAWLSALGLAFDRGPD
FT                   GALALGLEAAHGRRRIVKAGGDATGRAVLQTLARASAASPSISVVVGQATALAQDANGR
FT                   VAGLRACVNGASVDLPGRAVVLATGGLGGLYRATTNPAGALGSGLALAARAGAVLRDVE
FT                   FVQFHPTAIATGDAGPLPLATEALRGEGAILVNAAGERVMAGIAGAELAPRDVVARAIF
FT                   SRTSRGEAVFLDARRLDVARRFPTVAALCRKAGIDPAATPIPVSPAAHYHMGGIRVDGS
FT                   GRTSLPGLWACGEVASTGLHGANRLASNSLLEAMAFAAFIAADIRGLSSSAGRAAAEDA
FT                   PVPRPAALPEIRRIMEAEVGLVRNEAGLARAVARLGALAEAGSPEAAIGLLVAASALSR
FT                   RESRGAHWREDHPGQQEPRHAEITLAQARRLSASLAPLEVP"
     MSADRTLVVG AGVAGLATAL RLAPLPVTLL TGAPLGEGTA TAWAQGGIAA AIGPDDDPAL        60
     HAADTRAAGA GLTDPDVAQR VAEAGPGLVA WLSALGLAFD RGPDGALALG LEAAHGRRRI       120
     VKAGGDATGR AVLQTLARAS AASPSISVVV GQATALAQDA NGRVAGLRAC VNGASVDLPG       180
     RAVVLATGGL GGLYRATTNP AGALGSGLAL AARAGAVLRD VEFVQFHPTA IATGDAGPLP       240
     LATEALRGEG AILVNAAGER VMAGIAGAEL APRDVVARAI FSRTSRGEAV FLDARRLDVA       300
     RRFPTVAALC RKAGIDPAAT PIPVSPAAHY HMGGIRVDGS GRTSLPGLWA CGEVASTGLH       360
     GANRLASNSL LEAMAFAAFI AADIRGLSSS AGRAAAEDAP VPRPAALPEI RRIMEAEVGL       420
     VRNEAGLARA VARLGALAEA GSPEAAIGLL VAASALSRRE SRGAHWREDH PGQQEPRHAE       480
     ITLAQARRLS ASLAPLEVP                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page