(data stored in ACNUC7421 zone)

EMBL: CP001349.PE164

CP001349.PE164       Location/Qualifiers
FT   CDS             183690..184553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0170"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   met:M446_4589 nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55216"
FT                   /db_xref="GOA:B8I9G3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G3"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ACL55216.1"
FT                   /translation="MTDALPLSPLPRLLVEPIVRAALCEDLGRAGDLTTDSIVPAEARF
FT                   SGAIVARQTGVVAGTDAAALAFALLDPAVSVSVARPDGSAVAPGEAVITLDGPARAILS
FT                   AERVALNLLCRLSGIATATASLVEAARPHGRARIVCTRKTTPGLRTLEKHAVRAGGGSN
FT                   HRFGLDDAVLIKDNHLAVAGGVGPAIRRARAGVGHLVRIEVEVDTLAQLEEALALGADA
FT                   VLLDNMTPDELRRAVAMIDGRAISEASGRITRDSVGAVAASGVDLISTGWITHSAPIID
FT                   LGLDVA"
     MTDALPLSPL PRLLVEPIVR AALCEDLGRA GDLTTDSIVP AEARFSGAIV ARQTGVVAGT        60
     DAAALAFALL DPAVSVSVAR PDGSAVAPGE AVITLDGPAR AILSAERVAL NLLCRLSGIA       120
     TATASLVEAA RPHGRARIVC TRKTTPGLRT LEKHAVRAGG GSNHRFGLDD AVLIKDNHLA       180
     VAGGVGPAIR RARAGVGHLV RIEVEVDTLA QLEEALALGA DAVLLDNMTP DELRRAVAMI       240
     DGRAISEASG RITRDSVGAV AASGVDLIST GWITHSAPII DLGLDVA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page