(data stored in ACNUC7421 zone)

EMBL: CP001349.PE165

CP001349.PE165       Location/Qualifiers
FT   CDS             complement(184629..185363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0171"
FT                   /product="protein of unknown function DUF1236"
FT                   /note="PFAM: protein of unknown function DUF1236; KEGG:
FT                   met:M446_4588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55217"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G4"
FT                   /inference="protein motif:PFAM:PF06823"
FT                   /protein_id="ACL55217.1"
FT                   /translation="MNKLVRGTLTASILVLGAATAFAQGGPGGGAGAGGGGAGGAGVGG
FT                   GAGGGAGGGGGAGAPGTGGGGGAGGARGAQGGPGGAGGATTGSERGTAQQPGGTAGRAG
FT                   EAPGRAGGTADQGTQRGGAERTGERGERGAERGEHRGERTERGERTGAISEARGASSRL
FT                   DTHQRTEFRQTIVKSGVRPMHGVNFSLSVGTAVPRSVTLHALPPTIVSLVPAYRGLRYV
FT                   LVDDEIVIIDPDTYEIVDVIRG"
     MNKLVRGTLT ASILVLGAAT AFAQGGPGGG AGAGGGGAGG AGVGGGAGGG AGGGGGAGAP        60
     GTGGGGGAGG ARGAQGGPGG AGGATTGSER GTAQQPGGTA GRAGEAPGRA GGTADQGTQR       120
     GGAERTGERG ERGAERGEHR GERTERGERT GAISEARGAS SRLDTHQRTE FRQTIVKSGV       180
     RPMHGVNFSL SVGTAVPRSV TLHALPPTIV SLVPAYRGLR YVLVDDEIVI IDPDTYEIVD       240
     VIRG                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page