(data stored in ACNUC7421 zone)

EMBL: CP001349.PE166

CP001349.PE166       Location/Qualifiers
FT   CDS             complement(185765..186592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55218"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G5"
FT                   /inference="similar to AA sequence:KEGG:M446_4587"
FT                   /protein_id="ACL55218.1"
FT                   /translation="MRSILTAPSIGRWLPVLALAAGLSAAPAGAATLEATYRVTLAGLS
FT                   VGKAALRMEITDRRRYELHLDAALNGLARMLWGGQGSAQSRGVLDGAAVRPRAFQLDAL
FT                   YGGTPISERIMLDDGRITSVSMSPDARVRPDRVPPRPGDDRNVVDPLSALIGPQLSPPG
FT                   APTPRDCERTLPVHDGTARFDIPLGEGEAQTFGGTGYAGPVVLCRARYVPLSGHRPKRW
FT                   VVQYMRENRDLRVWLAPVGHSRVLAPVRIEVGTTFGTAMAEVTRWRIEEAASR"
     MRSILTAPSI GRWLPVLALA AGLSAAPAGA ATLEATYRVT LAGLSVGKAA LRMEITDRRR        60
     YELHLDAALN GLARMLWGGQ GSAQSRGVLD GAAVRPRAFQ LDALYGGTPI SERIMLDDGR       120
     ITSVSMSPDA RVRPDRVPPR PGDDRNVVDP LSALIGPQLS PPGAPTPRDC ERTLPVHDGT       180
     ARFDIPLGEG EAQTFGGTGY AGPVVLCRAR YVPLSGHRPK RWVVQYMREN RDLRVWLAPV       240
     GHSRVLAPVR IEVGTTFGTA MAEVTRWRIE EAASR                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page