(data stored in ACNUC7421 zone)

EMBL: CP001349.PE167

CP001349.PE167       Location/Qualifiers
FT   CDS             complement(186819..187124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55219"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G6"
FT                   /inference="similar to AA sequence:KEGG:M446_3665"
FT                   /protein_id="ACL55219.1"
FT                   /translation="MTSDDKINGLTVLSANHGEMIARLSEAQADVAAKQVALQMAIGFL
FT                   ARILRSIDSDHYRHELAGYLGMLEDALTRDDPDSDLARRVLETVRATLETGEGDED"
     MTSDDKINGL TVLSANHGEM IARLSEAQAD VAAKQVALQM AIGFLARILR SIDSDHYRHE        60
     LAGYLGMLED ALTRDDPDSD LARRVLETVR ATLETGEGDE D                           101
//

If you have problems or comments...

PBIL Back to PBIL home page