(data stored in ACNUC7421 zone)

EMBL: CP001349.PE168

CP001349.PE168       Location/Qualifiers
FT   CDS             complement(187247..189949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0174"
FT                   /product="aconitate hydratase 1"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: met:M446_3664 aconitate
FT                   hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55220"
FT                   /db_xref="GOA:B8I9G7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G7"
FT                   /inference="protein motif:TFAM:TIGR01341"
FT                   /protein_id="ACL55220.1"
FT                   /translation="MASIDSFKSRQTLQVGSKSYTYYSIAEAEKNGLPDASRLPFSMKV
FT                   LLENLLRFEDDRSVKKADIEAVTAWLGNRGEVETEIAFRPSRVLMQDFTGVPAVVDLAA
FT                   MRDAMVALGGDPKKINPLVPVDLVIDHSVIVDEFGTPKALADNVALEYQRNGERYTFLK
FT                   WGQAAFDNFSVVPPGTGICHQVNLEYLAQTVWTKAFENGQELAYPDSLVGTDSHTTMVN
FT                   GLAVLGWGVGGIEAEAAMLGQPLSMLIPEVVGFKLSGKLPEGTTATDLVLTVTQMLRKK
FT                   GVVGKFVEFYGPGLDDMAVADRATISNMAPEYGATCGFFPVDTRTLDYLRVTGRSDERI
FT                   ALVEAYAKAQGMWRDAATPDPVFTDTLELDLGDVKPSLAGPKRPQDRVLLDSAKPGFAA
FT                   SMETEFRKAADLAKRYPVEGANFDLGHGDVVIAAITSCTNTSNPSVMIGAGLLARNAIA
FT                   KGLRSKPWVKTSLAPGSQVVAEYLEKAGLQKSLDALGFNLVGFGCTTCIGNSGPLPAPI
FT                   SKAINDNDIVAAAVLSGNRNFEGRVNPDVRANYLASPPLVVAYALAGSLQVDLTRDPIG
FT                   TGSDGQPVYLKDIWPSSAEVNAFIEQTITSSLFKSRYADVFGGDANWKAVEVTPAQTFS
FT                   WNSGSTYVQNPPYFVGMQKTPAPVTDIVGARILGLFLDSITTDHISPAGNIRAASPAGK
FT                   YLQEHQVRVQDFNQYGTRRGNHEVMMRGTFANIRIKNQMVRDESGNVVEGGWTLYQPGG
FT                   EKMFIYDAAMRYQAEGTPLVVFAGKEYGTGSSRDWAAKGTKLLGVRAVIAESFERIHRS
FT                   NLVGMGVVPLVFQGDTTWDSLGLKGDETVTIRGLAGDLKPRQTLTAEITAADGTTKQVP
FT                   LTCRIDTLDELEYFRNGGILPYVLRQLAA"
     MASIDSFKSR QTLQVGSKSY TYYSIAEAEK NGLPDASRLP FSMKVLLENL LRFEDDRSVK        60
     KADIEAVTAW LGNRGEVETE IAFRPSRVLM QDFTGVPAVV DLAAMRDAMV ALGGDPKKIN       120
     PLVPVDLVID HSVIVDEFGT PKALADNVAL EYQRNGERYT FLKWGQAAFD NFSVVPPGTG       180
     ICHQVNLEYL AQTVWTKAFE NGQELAYPDS LVGTDSHTTM VNGLAVLGWG VGGIEAEAAM       240
     LGQPLSMLIP EVVGFKLSGK LPEGTTATDL VLTVTQMLRK KGVVGKFVEF YGPGLDDMAV       300
     ADRATISNMA PEYGATCGFF PVDTRTLDYL RVTGRSDERI ALVEAYAKAQ GMWRDAATPD       360
     PVFTDTLELD LGDVKPSLAG PKRPQDRVLL DSAKPGFAAS METEFRKAAD LAKRYPVEGA       420
     NFDLGHGDVV IAAITSCTNT SNPSVMIGAG LLARNAIAKG LRSKPWVKTS LAPGSQVVAE       480
     YLEKAGLQKS LDALGFNLVG FGCTTCIGNS GPLPAPISKA INDNDIVAAA VLSGNRNFEG       540
     RVNPDVRANY LASPPLVVAY ALAGSLQVDL TRDPIGTGSD GQPVYLKDIW PSSAEVNAFI       600
     EQTITSSLFK SRYADVFGGD ANWKAVEVTP AQTFSWNSGS TYVQNPPYFV GMQKTPAPVT       660
     DIVGARILGL FLDSITTDHI SPAGNIRAAS PAGKYLQEHQ VRVQDFNQYG TRRGNHEVMM       720
     RGTFANIRIK NQMVRDESGN VVEGGWTLYQ PGGEKMFIYD AAMRYQAEGT PLVVFAGKEY       780
     GTGSSRDWAA KGTKLLGVRA VIAESFERIH RSNLVGMGVV PLVFQGDTTW DSLGLKGDET       840
     VTIRGLAGDL KPRQTLTAEI TAADGTTKQV PLTCRIDTLD ELEYFRNGGI LPYVLRQLAA       900
//

If you have problems or comments...

PBIL Back to PBIL home page