(data stored in ACNUC7421 zone)

EMBL: CP001349.PE169

CP001349.PE169       Location/Qualifiers
FT   CDS             190529..191176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0175"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: met:M446_3663 heme exporter protein CcmA;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55221"
FT                   /db_xref="GOA:B8I9G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G8"
FT                   /inference="protein motif:TFAM:TIGR01189"
FT                   /protein_id="ACL55221.1"
FT                   /translation="MRLIAKGLACRRSGRRIFSGLSFTLDPGEALIVTGRNGAGKSSLL
FT                   AILSGRLSPEAGSLRAEDVGERTIPECLHGVGHRDGLKSALTAEENLAFARDLLGAATL
FT                   APREALARMGLAHAAGLPVAYLSAGQRRRVALARLLVCRRPLWLLDEPTAALDAASQAV
FT                   LAGLMRDHLAEGGLVVAATHQALGLTTARELSIEAFRPAAAAHTDPFAETAR"
     MRLIAKGLAC RRSGRRIFSG LSFTLDPGEA LIVTGRNGAG KSSLLAILSG RLSPEAGSLR        60
     AEDVGERTIP ECLHGVGHRD GLKSALTAEE NLAFARDLLG AATLAPREAL ARMGLAHAAG       120
     LPVAYLSAGQ RRRVALARLL VCRRPLWLLD EPTAALDAAS QAVLAGLMRD HLAEGGLVVA       180
     ATHQALGLTT ARELSIEAFR PAAAAHTDPF AETAR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page