(data stored in ACNUC7421 zone)

EMBL: CP001349.PE17

CP001349.PE17        Location/Qualifiers
FT   CDS             19635..20654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0018"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: met:M446_0013
FT                   ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55069"
FT                   /db_xref="GOA:B8IT07"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT07"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55069.1"
FT                   /translation="MRRAIYGVAACLLLIGGAGAAETALDREAVNTARFEPDRQTRETG
FT                   KQPDPLLVKVQVLLDRARFSPGVIDGRSGDNLEGALKAFAEARGMKASGRLDGALWDAL
FT                   AVTSQDPVLGDYTITEKDTAGPFVKEIPAKMEEQADLKALAYTGPAEMLAERFHMSRAL
FT                   FEALNPGKAFDKPGTLVTVAAVAPLELERPAAKSLPEEPKVQRIVVDKEALQVRAYGGD
FT                   GALLAVYPASIGSEEKPAPQGTFKVKGIVFDPDYTYDPKYGFAGVHAKHKFTIRPGPNN
FT                   PVGLVWIDLSAESYGIHGTPDPEKIGKTESHGCIRLTNWDARDLARHVVKGATVEIGG"
     MRRAIYGVAA CLLLIGGAGA AETALDREAV NTARFEPDRQ TRETGKQPDP LLVKVQVLLD        60
     RARFSPGVID GRSGDNLEGA LKAFAEARGM KASGRLDGAL WDALAVTSQD PVLGDYTITE       120
     KDTAGPFVKE IPAKMEEQAD LKALAYTGPA EMLAERFHMS RALFEALNPG KAFDKPGTLV       180
     TVAAVAPLEL ERPAAKSLPE EPKVQRIVVD KEALQVRAYG GDGALLAVYP ASIGSEEKPA       240
     PQGTFKVKGI VFDPDYTYDP KYGFAGVHAK HKFTIRPGPN NPVGLVWIDL SAESYGIHGT       300
     PDPEKIGKTE SHGCIRLTNW DARDLARHVV KGATVEIGG                              339
//

If you have problems or comments...

PBIL Back to PBIL home page