(data stored in ACNUC7421 zone)

EMBL: CP001349.PE170

CP001349.PE170       Location/Qualifiers
FT   CDS             191173..191841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0176"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   met:M446_3662 heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55222"
FT                   /db_xref="GOA:B8I9G9"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G9"
FT                   /inference="protein motif:TFAM:TIGR01190"
FT                   /protein_id="ACL55222.1"
FT                   /translation="MIRPFLAVLLRDLRLAGRIGGSGALSLVFFLMIVVLVPFALGPDL
FT                   NLLSRIGPAILWLAAVLATLIGLDRLFQADEEDGSLDLLTGAPVPLELVVLAKALAHWL
FT                   TTGLPLALAAPLFGLLVALTPSAMAATSLTLLVGTPALTFIGAVGAALTASIRRGGLIL
FT                   AVVVLPLMIPTLIFGVSAADSATGGTVPFATPLGILGALSLVAGVVGTLGAAAALRWSE
FT                   "
     MIRPFLAVLL RDLRLAGRIG GSGALSLVFF LMIVVLVPFA LGPDLNLLSR IGPAILWLAA        60
     VLATLIGLDR LFQADEEDGS LDLLTGAPVP LELVVLAKAL AHWLTTGLPL ALAAPLFGLL       120
     VALTPSAMAA TSLTLLVGTP ALTFIGAVGA ALTASIRRGG LILAVVVLPL MIPTLIFGVS       180
     AADSATGGTV PFATPLGILG ALSLVAGVVG TLGAAAALRW SE                          222
//

If you have problems or comments...

PBIL Back to PBIL home page