(data stored in ACNUC7421 zone)

EMBL: CP001349.PE172

CP001349.PE172       Location/Qualifiers
FT   CDS             192140..192904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0178"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: met:M446_3660 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55224"
FT                   /db_xref="GOA:B8I9H1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H1"
FT                   /inference="protein motif:TFAM:TIGR01191"
FT                   /protein_id="ACL55224.1"
FT                   /translation="MAQGLFTRLAQPSHFLRWSGAALPWISGLAALLLAAGLYLSVFVA
FT                   PADYQQGETVRIMFIHVPAAWLGVFFYGAMAVSALGTLVWRHPLADVAQRAAAPVGAAF
FT                   TLICLVTGSLWGKPMWGTYWVWDARLTSMLVLLLIYCGLLALWRTIEDPGRAARAVAIL
FT                   TLVGAVNLPIIKFSVNWWSTLHQPASILRMGGPTIHPTMLYPLLVMIAAFSVLGIALHL
FT                   AAMRTEILRRRVRTLAILEAERLDGLPAPQAA"
     MAQGLFTRLA QPSHFLRWSG AALPWISGLA ALLLAAGLYL SVFVAPADYQ QGETVRIMFI        60
     HVPAAWLGVF FYGAMAVSAL GTLVWRHPLA DVAQRAAAPV GAAFTLICLV TGSLWGKPMW       120
     GTYWVWDARL TSMLVLLLIY CGLLALWRTI EDPGRAARAV AILTLVGAVN LPIIKFSVNW       180
     WSTLHQPASI LRMGGPTIHP TMLYPLLVMI AAFSVLGIAL HLAAMRTEIL RRRVRTLAIL       240
     EAERLDGLPA PQAA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page