(data stored in ACNUC7421 zone)

EMBL: CP001349.PE174

CP001349.PE174       Location/Qualifiers
FT   CDS             193075..193662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0180"
FT                   /product="periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein; Thioredoxin domain; KEGG: met:M446_3658
FT                   periplasmic protein thiol--disulphide oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55226"
FT                   /db_xref="GOA:B8I9H3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H3"
FT                   /inference="protein motif:TFAM:TIGR00385"
FT                   /protein_id="ACL55226.1"
FT                   /translation="MSATEESEGASPRRGLLFLLPLLVFAALAGLFLGRLLTTGYDPSA
FT                   VPSALIGKPVPAFSLPALTGLTADGQPVPGLSSDDLKGKVTVLNVWASWCTPCQAEHPM
FT                   LMRLSQDGVNLVGIDYKDAPENGRRFLGRHGNPFRAVGMDESGRTGIDFGVYGVPETFV
FT                   IGPDGRIRDKLVGILTPENYAGFLEKVRAAAK"
     MSATEESEGA SPRRGLLFLL PLLVFAALAG LFLGRLLTTG YDPSAVPSAL IGKPVPAFSL        60
     PALTGLTADG QPVPGLSSDD LKGKVTVLNV WASWCTPCQA EHPMLMRLSQ DGVNLVGIDY       120
     KDAPENGRRF LGRHGNPFRA VGMDESGRTG IDFGVYGVPE TFVIGPDGRI RDKLVGILTP       180
     ENYAGFLEKV RAAAK                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page