(data stored in ACNUC7421 zone)

EMBL: CP001349.PE175

CP001349.PE175       Location/Qualifiers
FT   CDS             193897..194949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0181"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: rpe:RPE_4214 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55227"
FT                   /db_xref="GOA:B8I9H4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55227.1"
FT                   /translation="MSEIIRIGLDTSKSVFQLHGVDAAERPVLKLKLSRSKMLAFFAQQ
FT                   PPCLVALEACGASHHWARTLAGLGHTVRLIAPQHVKPYVPGSKTDAADAAGLCEAVSRP
FT                   QMRFVPVKTAEQQAALMLTGLREQWLKRRTQVSNSLRGYAAEFGLAAPQGLARLAELVA
FT                   RLAEDPRVPALARPLFAALWAEYQEIEARVQEADRQLKVWQRGNASCRRLSAVPGIGPV
FT                   GAALLVLKTPAPQAFRSGRDFAAWLGLTPKDHATAGKPRLGGITRAGDEQLRSVLVAGA
FT                   MAVLRQLKPESAGLAGWLTRLVARKARRLVAVALANKLARIAWRLLVSGASYDPARAGP
FT                   PMGGAEPARA"
     MSEIIRIGLD TSKSVFQLHG VDAAERPVLK LKLSRSKMLA FFAQQPPCLV ALEACGASHH        60
     WARTLAGLGH TVRLIAPQHV KPYVPGSKTD AADAAGLCEA VSRPQMRFVP VKTAEQQAAL       120
     MLTGLREQWL KRRTQVSNSL RGYAAEFGLA APQGLARLAE LVARLAEDPR VPALARPLFA       180
     ALWAEYQEIE ARVQEADRQL KVWQRGNASC RRLSAVPGIG PVGAALLVLK TPAPQAFRSG       240
     RDFAAWLGLT PKDHATAGKP RLGGITRAGD EQLRSVLVAG AMAVLRQLKP ESAGLAGWLT       300
     RLVARKARRL VAVALANKLA RIAWRLLVSG ASYDPARAGP PMGGAEPARA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page