(data stored in ACNUC7421 zone)

EMBL: CP001349.PE176

CP001349.PE176       Location/Qualifiers
FT   CDS             complement(195284..195994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0182"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: met:M446_3657 transcription activator effector
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55228"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H5"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACL55228.1"
FT                   /translation="MTVSRLPLTALGLVLALAAGPGAPRAQQPPAQANPLPTTTDPGQG
FT                   SRPGEAPQPPLPEKAVPPAPPPAGARQTLVQAPGDPSDVDEVTLPAKPVAIVSGNAKWD
FT                   AAVPTLRDSFARIESDLAKAGIKAVGRPVAVFTRTDDDGFQYEAMIPIEQVPDPKPAGL
FT                   PAELRFGSTPSGKALRFVHKGAYDEIDQTYETVTAYLDAKGIIVQDAFVEEYLTDLKSA
FT                   SDTGLEVNIYALPK"
     MTVSRLPLTA LGLVLALAAG PGAPRAQQPP AQANPLPTTT DPGQGSRPGE APQPPLPEKA        60
     VPPAPPPAGA RQTLVQAPGD PSDVDEVTLP AKPVAIVSGN AKWDAAVPTL RDSFARIESD       120
     LAKAGIKAVG RPVAVFTRTD DDGFQYEAMI PIEQVPDPKP AGLPAELRFG STPSGKALRF       180
     VHKGAYDEID QTYETVTAYL DAKGIIVQDA FVEEYLTDLK SASDTGLEVN IYALPK           236
//

If you have problems or comments...

PBIL Back to PBIL home page