(data stored in ACNUC7421 zone)

EMBL: CP001349.PE177

CP001349.PE177       Location/Qualifiers
FT   CDS             196165..197046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0183"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: met:M446_3656
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55229"
FT                   /db_xref="GOA:B8I9H6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9H6"
FT                   /inference="protein motif:PFAM:PF01678"
FT                   /protein_id="ACL55229.1"
FT                   /translation="MSPLAHRRFLKMNGLGNEIVVLDLRGTPHIVQPQEARAIAADPRS
FT                   RFDQLMVLHDPVTAGTDAALRIYNTDGSESGACGNGTRCVAWAMLEDPVMGRPAERLTL
FT                   QSRAGLLAVTRVSATDFTVDMGPPRLRWDEIPLAEPFPDTRRIELQIGPIDDPILHSPG
FT                   VVSMGNPHAVFFVDRDPASYDLARIGPLLEAHPIFPERANISVAQVRGPEHIVLRVWER
FT                   GAGLTRACGSAACAALVAAARLRLTGRRAVVTLPGGDLVIDWGEDDHVRMTGPTELEWE
FT                   GTLAPSLFAGAA"
     MSPLAHRRFL KMNGLGNEIV VLDLRGTPHI VQPQEARAIA ADPRSRFDQL MVLHDPVTAG        60
     TDAALRIYNT DGSESGACGN GTRCVAWAML EDPVMGRPAE RLTLQSRAGL LAVTRVSATD       120
     FTVDMGPPRL RWDEIPLAEP FPDTRRIELQ IGPIDDPILH SPGVVSMGNP HAVFFVDRDP       180
     ASYDLARIGP LLEAHPIFPE RANISVAQVR GPEHIVLRVW ERGAGLTRAC GSAACAALVA       240
     AARLRLTGRR AVVTLPGGDL VIDWGEDDHV RMTGPTELEW EGTLAPSLFA GAA              293
//

If you have problems or comments...

PBIL Back to PBIL home page