(data stored in ACNUC7421 zone)

EMBL: CP001349.PE178

CP001349.PE178       Location/Qualifiers
FT   CDS             197046..198284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0184"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: met:M446_3655 MiaB-like tRNA modifying enzyme;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme; PFAM: Radical SAM domain protein;
FT                   Protein of unknown function UPF0004; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55230"
FT                   /db_xref="GOA:B8I9H7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H7"
FT                   /inference="protein motif:TFAM:TIGR01579"
FT                   /protein_id="ACL55230.1"
FT                   /translation="MPVEVLSFGCRLNTAEGEVLRRAAETGRPGEDLVVVNTCAVTAEA
FT                   TRQARKAIRGAARRTPGARIVVTGCGAQVETAAYAAMPEVAAIIGNHAKLSPAAWADRA
FT                   GGRVRVEDIMAVREAAAAPTPRMPGRTRAVLPVQNGCDHRCTFCVIPFGRGPSRSLPVQ
FT                   EAIAQARALVEDGAREVVLTGVDLTAYGRDLPEAPSLGGLVKAILRALPDLDRLRLSSI
FT                   DSVEADADLLDALASERRLMPHLHLSLQAGDDLILKRMKRRHARADAIAFCETVRRLRP
FT                   EIVFGADLIAGFPTETEAQFGRSVALVEECGLAHLHVFPYSPRPETPAARMPQLPAEII
FT                   RDRAARLRAAGEAALGRRLDREVGQVRAVLAERGGIGRTEGFLPVRLPDGVAPGTLRAV
FT                   AITGHDGRVLAAA"
     MPVEVLSFGC RLNTAEGEVL RRAAETGRPG EDLVVVNTCA VTAEATRQAR KAIRGAARRT        60
     PGARIVVTGC GAQVETAAYA AMPEVAAIIG NHAKLSPAAW ADRAGGRVRV EDIMAVREAA       120
     AAPTPRMPGR TRAVLPVQNG CDHRCTFCVI PFGRGPSRSL PVQEAIAQAR ALVEDGAREV       180
     VLTGVDLTAY GRDLPEAPSL GGLVKAILRA LPDLDRLRLS SIDSVEADAD LLDALASERR       240
     LMPHLHLSLQ AGDDLILKRM KRRHARADAI AFCETVRRLR PEIVFGADLI AGFPTETEAQ       300
     FGRSVALVEE CGLAHLHVFP YSPRPETPAA RMPQLPAEII RDRAARLRAA GEAALGRRLD       360
     REVGQVRAVL AERGGIGRTE GFLPVRLPDG VAPGTLRAVA ITGHDGRVLA AA               412
//

If you have problems or comments...

PBIL Back to PBIL home page