(data stored in ACNUC7421 zone)

EMBL: CP001349.PE179

CP001349.PE179       Location/Qualifiers
FT   CDS             complement(199716..200144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0186"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_3654 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55231"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55231.1"
FT                   /translation="MDEGQGGTIFGAEIPFARLCGVEALRFENGRTHLRLVLGPEHANN
FT                   LGIAHGGVLCTLLDIAMGTVARLTAGRPVVTLDMQTRFLSPGRGVLLAEGRVVRAGQSI
FT                   LFCDAEVRGEAGTLVASASGVFKPTGLREPASRRPGES"
     MDEGQGGTIF GAEIPFARLC GVEALRFENG RTHLRLVLGP EHANNLGIAH GGVLCTLLDI        60
     AMGTVARLTA GRPVVTLDMQ TRFLSPGRGV LLAEGRVVRA GQSILFCDAE VRGEAGTLVA       120
     SASGVFKPTG LREPASRRPG ES                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page