(data stored in ACNUC7421 zone)

EMBL: CP001349.PE18

CP001349.PE18        Location/Qualifiers
FT   CDS             complement(20817..21560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0016
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55070"
FT                   /db_xref="GOA:B8IT08"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT08"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55070.1"
FT                   /translation="MSPRWSGALGTAAIGLLLAALAHPAVAGLVARAAGLSAGAPVPLD
FT                   RLLWLAQRHLFLALAGFALAGGLGLALGILATRTGGARLRGPIDALAAAAQAAPPVVVI
FT                   GLALPVLGFGAPPTLLALACYGLMPVLRATSDALGNVPEEVRAAAIAMGLTPAQLFWRV
FT                   DLPLAAGPILAALRVAMVVAVATAAVGALAGAPTLGTPIVVGLQNQNGLPLLQGAAAAA
FT                   ALAFLADAVVLAVEAVVRRPGQDPS"
     MSPRWSGALG TAAIGLLLAA LAHPAVAGLV ARAAGLSAGA PVPLDRLLWL AQRHLFLALA        60
     GFALAGGLGL ALGILATRTG GARLRGPIDA LAAAAQAAPP VVVIGLALPV LGFGAPPTLL       120
     ALACYGLMPV LRATSDALGN VPEEVRAAAI AMGLTPAQLF WRVDLPLAAG PILAALRVAM       180
     VVAVATAAVG ALAGAPTLGT PIVVGLQNQN GLPLLQGAAA AAALAFLADA VVLAVEAVVR       240
     RPGQDPS                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page