(data stored in ACNUC7421 zone)

EMBL: CP001349.PE180

CP001349.PE180       Location/Qualifiers
FT   CDS             200219..200908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0187"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: met:M446_3653
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55232"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H9"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACL55232.1"
FT                   /translation="MSRSTSHSFVRTRWWWVRHAPVRGDGGRIYGGSDIPCDCGDAHVF
FT                   AGLAPVLPRGAIWVSSHLGRTRQTAEALWQAGDFSVDGAAPALTALPALAEQNLGDWQG
FT                   QDRARFFAERQPMAESYWFAPAEERPPNGESFAEMCGRVHAAIADLTDEHRGRDIVAVA
FT                   HGGTIRAAIALALALPPQGGLAFAIENCSLTRLDHYDSPDGSGWRIGMVNGQPWLGAGL
FT                   EGGGPAA"
     MSRSTSHSFV RTRWWWVRHA PVRGDGGRIY GGSDIPCDCG DAHVFAGLAP VLPRGAIWVS        60
     SHLGRTRQTA EALWQAGDFS VDGAAPALTA LPALAEQNLG DWQGQDRARF FAERQPMAES       120
     YWFAPAEERP PNGESFAEMC GRVHAAIADL TDEHRGRDIV AVAHGGTIRA AIALALALPP       180
     QGGLAFAIEN CSLTRLDHYD SPDGSGWRIG MVNGQPWLGA GLEGGGPAA                   229
//

If you have problems or comments...

PBIL Back to PBIL home page