(data stored in ACNUC7421 zone)

EMBL: CP001349.PE181

CP001349.PE181       Location/Qualifiers
FT   CDS             complement(200928..203126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0188"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="TIGRFAM: malate synthase G; PFAM: malate synthase;
FT                   KEGG: met:M446_3652 malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55233"
FT                   /db_xref="GOA:B8I9I0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I0"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ACL55233.1"
FT                   /translation="MDRQTVSGLKVARVLHDFVVREALPGTGVSPEVFWGGLAAILRDL
FT                   TPKNRALLAKRDALQDRIDAWHRERVGRPIDAAEYERFLREIGYLLPDPGPVKARTENV
FT                   DDEIATIAGPQLVVPVSNARYALNAANARWGSLYDAFYGTDAISEEGGATRGPGYNRTR
FT                   GARVVTRARAFLDRTVPLAGGRHADVVTYAVENGGLVGNMNTGETIPLARPEAFVGYRG
FT                   RASMPSALLLRHNGLHIEIVLDRTHRIGRFDASGVADILIESAISTIMDLEDSVAAVDA
FT                   DDKVEVYRNWLGLMNGTLSARFEKDGRVMERRLNPDRHYTAPNGGEVTVPGRSLMLVRN
FT                   VGHHMVTDAVLDAEGNEVPEGILDAAVTAMIAIHDLRNESGLRNSRKGSVYIVKPKMHG
FT                   PEEVAFAVELFGRVEAMLGLERNTLKMGIMDEERRTTVNLAACIKAADERVVFINTGFL
FT                   DRTGDEIHTAMEAGPVIRKNDMKATPWIKGYEENNVDVGLACGLLGRAQIGKGMWAAPD
FT                   AMADMLMQKGAHPKAGASTAWVPSPTAATLHALHYHETDVHARQEELARRPRSALAEIL
FT                   QIPLARSNFAPDDVQQEIDNNAQSILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRI
FT                   SSQHIANWLHHGVVSEEQVVETLKRMAKVVDRQNAGDPLYRPMAPAFDGPAFRAACDLV
FT                   FKGRVQPNGYTEWILHARRREAKAAGAPTEKAREGATA"
     MDRQTVSGLK VARVLHDFVV REALPGTGVS PEVFWGGLAA ILRDLTPKNR ALLAKRDALQ        60
     DRIDAWHRER VGRPIDAAEY ERFLREIGYL LPDPGPVKAR TENVDDEIAT IAGPQLVVPV       120
     SNARYALNAA NARWGSLYDA FYGTDAISEE GGATRGPGYN RTRGARVVTR ARAFLDRTVP       180
     LAGGRHADVV TYAVENGGLV GNMNTGETIP LARPEAFVGY RGRASMPSAL LLRHNGLHIE       240
     IVLDRTHRIG RFDASGVADI LIESAISTIM DLEDSVAAVD ADDKVEVYRN WLGLMNGTLS       300
     ARFEKDGRVM ERRLNPDRHY TAPNGGEVTV PGRSLMLVRN VGHHMVTDAV LDAEGNEVPE       360
     GILDAAVTAM IAIHDLRNES GLRNSRKGSV YIVKPKMHGP EEVAFAVELF GRVEAMLGLE       420
     RNTLKMGIMD EERRTTVNLA ACIKAADERV VFINTGFLDR TGDEIHTAME AGPVIRKNDM       480
     KATPWIKGYE ENNVDVGLAC GLLGRAQIGK GMWAAPDAMA DMLMQKGAHP KAGASTAWVP       540
     SPTAATLHAL HYHETDVHAR QEELARRPRS ALAEILQIPL ARSNFAPDDV QQEIDNNAQS       600
     ILGYVVRWID QGVGCSKVPD IHDVGLMEDR ATLRISSQHI ANWLHHGVVS EEQVVETLKR       660
     MAKVVDRQNA GDPLYRPMAP AFDGPAFRAA CDLVFKGRVQ PNGYTEWILH ARRREAKAAG       720
     APTEKAREGA TA                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page