(data stored in ACNUC7421 zone)

EMBL: CP001349.PE182

CP001349.PE182       Location/Qualifiers
FT   CDS             203447..204169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0189"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="KEGG: met:M446_3651 putative periplasmic
FT                   ligand-binding sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55234"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I1"
FT                   /inference="similar to AA sequence:KEGG:M446_3651"
FT                   /protein_id="ACL55234.1"
FT                   /translation="MNSEERDVINGIFQRLEQAAQQPRDADAERFIADKLRAQPYAPYA
FT                   MAQLIYVQEEAIKSLNQQLEQARAELQQGQGAGQGSGGGFFSSIFGGGSRQEPPRQSAW
FT                   GGQPGYGQQPPGYGPGGYPQQGGYGQPGYGQPGYAPQQGGPWGGQPAPQRSGFLASALP
FT                   MAAGAAGGMLLGSALANAFSGGHSQLGSLGAADLGGAAGAQNAGGEDFGAPLGGGADFQ
FT                   DASFDDGDGDSGGGDDWV"
     MNSEERDVIN GIFQRLEQAA QQPRDADAER FIADKLRAQP YAPYAMAQLI YVQEEAIKSL        60
     NQQLEQARAE LQQGQGAGQG SGGGFFSSIF GGGSRQEPPR QSAWGGQPGY GQQPPGYGPG       120
     GYPQQGGYGQ PGYGQPGYAP QQGGPWGGQP APQRSGFLAS ALPMAAGAAG GMLLGSALAN       180
     AFSGGHSQLG SLGAADLGGA AGAQNAGGED FGAPLGGGAD FQDASFDDGD GDSGGGDDWV       240
//

If you have problems or comments...

PBIL Back to PBIL home page