(data stored in ACNUC7421 zone)

EMBL: CP001349.PE183

CP001349.PE183       Location/Qualifiers
FT   CDS             complement(204335..205126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0190"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   met:M446_3650 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55235"
FT                   /db_xref="GOA:B8I9I2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I2"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55235.1"
FT                   /translation="MRVGVWLAAGVAACATVAEASAQEAGRYGGGFIEFLMTGRDPGSV
FT                   ARPLRPAPVAADGTLIPREQGMAPAYATSLRSGDLVRASPMAAYEPTPPRTRMAALPQG
FT                   LPEDAAGIGRALDGRYRRQIVPYAGGQKPGTVVIDTTSRFLYLVQPGGQAIRYGIGVGR
FT                   PGFTWAGIKTITQKREWPDWTPPPEMLRRRPDLPRHMEGGPANPLGARALYLGSSLYRI
FT                   HGTNEPHTIGQSVSSGCIRMMNEDVIDLYERVPVGATVIVS"
     MRVGVWLAAG VAACATVAEA SAQEAGRYGG GFIEFLMTGR DPGSVARPLR PAPVAADGTL        60
     IPREQGMAPA YATSLRSGDL VRASPMAAYE PTPPRTRMAA LPQGLPEDAA GIGRALDGRY       120
     RRQIVPYAGG QKPGTVVIDT TSRFLYLVQP GGQAIRYGIG VGRPGFTWAG IKTITQKREW       180
     PDWTPPPEML RRRPDLPRHM EGGPANPLGA RALYLGSSLY RIHGTNEPHT IGQSVSSGCI       240
     RMMNEDVIDL YERVPVGATV IVS                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page