(data stored in ACNUC7421 zone)

EMBL: CP001349.PE184

CP001349.PE184       Location/Qualifiers
FT   CDS             205381..206091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0191"
FT                   /product="putative chemotaxis phosphatase, CheZ"
FT                   /note="KEGG: met:M446_3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55236"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I3"
FT                   /inference="similar to AA sequence:KEGG:M446_3649"
FT                   /protein_id="ACL55236.1"
FT                   /translation="MKNKRFRIEDSLGAPPLPVAPAPAPEPDERISEILATVNELKRLT
FT                   QTTTGDMIEACRREIGEIYGLKAELDLMKEAINRTKTEIAALYRKDNDGKGVRRAAGEL
FT                   DAVVEATERATTTILAAVEDIETHAAVIRSTGNLKDHSSVDAILERTVMLYEACNFQDL
FT                   TGQRISKIVSVLKFVEEHIDRMIDAWGGLDAFKDMIGASMETGPFDESSLLNGPKLDED
FT                   PGHVDQADIDALFN"
     MKNKRFRIED SLGAPPLPVA PAPAPEPDER ISEILATVNE LKRLTQTTTG DMIEACRREI        60
     GEIYGLKAEL DLMKEAINRT KTEIAALYRK DNDGKGVRRA AGELDAVVEA TERATTTILA       120
     AVEDIETHAA VIRSTGNLKD HSSVDAILER TVMLYEACNF QDLTGQRISK IVSVLKFVEE       180
     HIDRMIDAWG GLDAFKDMIG ASMETGPFDE SSLLNGPKLD EDPGHVDQAD IDALFN           236
//

If you have problems or comments...

PBIL Back to PBIL home page