(data stored in ACNUC7421 zone)

EMBL: CP001349.PE185

CP001349.PE185       Location/Qualifiers
FT   CDS             complement(212089..212763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0192"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: mlo:mll0909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55237"
FT                   /db_xref="GOA:B8I9I4"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I4"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACL55237.1"
FT                   /translation="MMRMALHTLVGTVLLGLVLFGPAGTLAWPEGWWFLALFIGCGVAI
FT                   GIWLALTDPGLLAARMASPFSADQAPRDRVVMALIALAFSVWLPAMALDARRFGWSHAP
FT                   LWTQVLGAVLVLAAFAGWVWVLRTNSFAAVTVRVQTERGQTVVSTGPYAFVRHPMYAFA
FT                   LLMLVGTPLLLGSLWGLAGLVLFVPLLAARALSEEAVLTEGLDGYRDYVRRVRYRLLPG
FT                   IW"
     MMRMALHTLV GTVLLGLVLF GPAGTLAWPE GWWFLALFIG CGVAIGIWLA LTDPGLLAAR        60
     MASPFSADQA PRDRVVMALI ALAFSVWLPA MALDARRFGW SHAPLWTQVL GAVLVLAAFA       120
     GWVWVLRTNS FAAVTVRVQT ERGQTVVSTG PYAFVRHPMY AFALLMLVGT PLLLGSLWGL       180
     AGLVLFVPLL AARALSEEAV LTEGLDGYRD YVRRVRYRLL PGIW                        224
//

If you have problems or comments...

PBIL Back to PBIL home page