(data stored in ACNUC7421 zone)

EMBL: CP001349.PE186

CP001349.PE186       Location/Qualifiers
FT   CDS             213151..214866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0193"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   PFAM: K transporting ATPase A subunit; KEGG:
FT                   mrd:Mrad2831_0209 potassium-transporting ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55238"
FT                   /db_xref="GOA:B8I9I5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9I5"
FT                   /inference="protein motif:TFAM:TIGR00680"
FT                   /protein_id="ACL55238.1"
FT                   /translation="MTLNGWTQITLYGAVVLALVKPLGWYMTRVFTGERTLLSPVLAPI
FT                   ERGLYRAAGIDARQEQTWLGYAGALLLFHVFGFLVLYAILRLQAALPLNPADQAAVAPD
FT                   LAFNTSASFITNTNWQNYGGESTLSYLSQMLGLTHQNFLSAATGIAVAVALIRGFARAS
FT                   TRTLGSFWVDLTRAILYVLLPICILYTLFLVWQGIPQTLGAYIDATTLEGGKQTIALGP
FT                   VASQVAIKMLGTNGGGFFNANAAHPFENPTALSNFVQMVSIFAIGAALTNVFGRMVGDE
FT                   RQGWAILAAMGALFLAGVAVAYWAEANGSPVLASFGLSGGNLEGKEVRFDIAASALFAV
FT                   VTTAASCGAVNAMHDSFTALGGMIPLVNMQLGEVIIGGVGAGLYGMLIFVVVAIFVAGL
FT                   MVGRTPEYLGKKIETKEVKMAMLGILCLPLMMLGFTALATVLPTGLAGPANAGPHGFSE
FT                   ILYAYTSAAANNGSAFAGLSGNTPFYNATLAVGMLVGRFFVIIPALAIAGALAAKKTVP
FT                   ASAGTFPTDGALFVGLLVGVILIIGGLTFFPALALGPVVEHLAGAAGQTFAMGD"
     MTLNGWTQIT LYGAVVLALV KPLGWYMTRV FTGERTLLSP VLAPIERGLY RAAGIDARQE        60
     QTWLGYAGAL LLFHVFGFLV LYAILRLQAA LPLNPADQAA VAPDLAFNTS ASFITNTNWQ       120
     NYGGESTLSY LSQMLGLTHQ NFLSAATGIA VAVALIRGFA RASTRTLGSF WVDLTRAILY       180
     VLLPICILYT LFLVWQGIPQ TLGAYIDATT LEGGKQTIAL GPVASQVAIK MLGTNGGGFF       240
     NANAAHPFEN PTALSNFVQM VSIFAIGAAL TNVFGRMVGD ERQGWAILAA MGALFLAGVA       300
     VAYWAEANGS PVLASFGLSG GNLEGKEVRF DIAASALFAV VTTAASCGAV NAMHDSFTAL       360
     GGMIPLVNMQ LGEVIIGGVG AGLYGMLIFV VVAIFVAGLM VGRTPEYLGK KIETKEVKMA       420
     MLGILCLPLM MLGFTALATV LPTGLAGPAN AGPHGFSEIL YAYTSAAANN GSAFAGLSGN       480
     TPFYNATLAV GMLVGRFFVI IPALAIAGAL AAKKTVPASA GTFPTDGALF VGLLVGVILI       540
     IGGLTFFPAL ALGPVVEHLA GAAGQTFAMG D                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page