(data stored in ACNUC7421 zone)

EMBL: CP001349.PE188

CP001349.PE188       Location/Qualifiers
FT   CDS             215171..217276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0195"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   mrd:Mrad2831_0207 K+-transporting ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55240"
FT                   /db_xref="GOA:B8I9I7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I7"
FT                   /inference="protein motif:TFAM:TIGR01497"
FT                   /protein_id="ACL55240.1"
FT                   /translation="MARQISSLFSAALIGPALIGAVRKLDPRILIRNPVMFVVEVVAAL
FT                   TTVLFVRDVLTGGADLAFTGQIILWLWFTVLFANFAEAIAEGRGKAQADALRRTRTEMT
FT                   AKLLTGPAASVGGPRSGFRVVPGTTLRVGDVVLVEAGDLIPSDGEVIEGVASVNEAAIT
FT                   GESAPVIRESGGDRSAVTGGTQVLSDWIRVRITAAAGSTFVDRMIALVEGAARQKTPNE
FT                   IALNILLAGLTIIFVIAVATIPSFAAYAGGAIPMVVLVALFVTLIPTTIGALLSAIGIA
FT                   GMDRLVRFNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRQAAEFRPLRGVTEQELADA
FT                   AQLASLADETPEGRSIVVLTKERYGIRARDMASLHATFVPFTAQSRMSGVDLDGSSIRK
FT                   GAVDAILAHVTASATAVVPSGAIRVMQPQVSAAAVREVQAITEEIAKAGGTPLAVARGG
FT                   RLLGVVHLKDIVKGGIRERFAELRRMGIRTVMITGDNPVTAAAIAAEAGVDDFLAQATP
FT                   EDKLALIRKEQQQGKLVAMCGDGTNDAPALAQADVGVAMNTGTVAAREAGNMVDLDSDP
FT                   TKLIEIVEIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFVTLYPQLQALNVMGLASPQ
FT                   SAILSAIIFNALIIVALIPLALKGVRYRAVGAAALLRRNLMIYGLGGILVPFAGIKLID
FT                   LAVSALL"
     MARQISSLFS AALIGPALIG AVRKLDPRIL IRNPVMFVVE VVAALTTVLF VRDVLTGGAD        60
     LAFTGQIILW LWFTVLFANF AEAIAEGRGK AQADALRRTR TEMTAKLLTG PAASVGGPRS       120
     GFRVVPGTTL RVGDVVLVEA GDLIPSDGEV IEGVASVNEA AITGESAPVI RESGGDRSAV       180
     TGGTQVLSDW IRVRITAAAG STFVDRMIAL VEGAARQKTP NEIALNILLA GLTIIFVIAV       240
     ATIPSFAAYA GGAIPMVVLV ALFVTLIPTT IGALLSAIGI AGMDRLVRFN VLAMSGRAVE       300
     AAGDVDTLLL DKTGTITLGN RQAAEFRPLR GVTEQELADA AQLASLADET PEGRSIVVLT       360
     KERYGIRARD MASLHATFVP FTAQSRMSGV DLDGSSIRKG AVDAILAHVT ASATAVVPSG       420
     AIRVMQPQVS AAAVREVQAI TEEIAKAGGT PLAVARGGRL LGVVHLKDIV KGGIRERFAE       480
     LRRMGIRTVM ITGDNPVTAA AIAAEAGVDD FLAQATPEDK LALIRKEQQQ GKLVAMCGDG       540
     TNDAPALAQA DVGVAMNTGT VAAREAGNMV DLDSDPTKLI EIVEIGKQLL MTRGALTTFS       600
     IANDVAKYFA IIPAMFVTLY PQLQALNVMG LASPQSAILS AIIFNALIIV ALIPLALKGV       660
     RYRAVGAAAL LRRNLMIYGL GGILVPFAGI KLIDLAVSAL L                           701
//

If you have problems or comments...

PBIL Back to PBIL home page