(data stored in ACNUC7421 zone)

EMBL: CP001349.PE189

CP001349.PE189       Location/Qualifiers
FT   CDS             217354..217959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0196"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="TIGRFAM: potassium-transporting ATPase, C subunit;
FT                   PFAM: K transporting ATPase KdpC subunit; KEGG:
FT                   mrd:Mrad2831_0206 potassium-transporting ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55241"
FT                   /db_xref="GOA:B8I9I8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9I8"
FT                   /inference="protein motif:TFAM:TIGR00681"
FT                   /protein_id="ACL55241.1"
FT                   /translation="MLQHLRPTLVLGVALTLLTGLAYPLAMTGLAGILFPVEAAGSLVE
FT                   RDGKVVGSRLIGQSFTGDRFFHGRPSATTAPDPTDASKTMPAPYNAANSGGSNLGPTSA
FT                   ALADRVKADVERLRAENPGAPVPVDLVTTSGSGLDPDISPEAALFQVPRIAKARHLPEE
FT                   RLRDLVAAQVQGRTLGLIGEPRVNVLALNLALDELAGK"
     MLQHLRPTLV LGVALTLLTG LAYPLAMTGL AGILFPVEAA GSLVERDGKV VGSRLIGQSF        60
     TGDRFFHGRP SATTAPDPTD ASKTMPAPYN AANSGGSNLG PTSAALADRV KADVERLRAE       120
     NPGAPVPVDL VTTSGSGLDP DISPEAALFQ VPRIAKARHL PEERLRDLVA AQVQGRTLGL       180
     IGEPRVNVLA LNLALDELAG K                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page