(data stored in ACNUC7421 zone)

EMBL: CP001349.PE19

CP001349.PE19        Location/Qualifiers
FT   CDS             complement(21557..22696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0017
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55071"
FT                   /db_xref="GOA:B8IT09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT09"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55071.1"
FT                   /translation="MTLGARPLPVLAFAAAATAAAALAGLPLLTLAPNRLVPGAPVGAG
FT                   WAGAGAALLGLLAAGLLSGTRRRDALLALAAALTGLAVLGLGIGAGAAGLLAGQPPAAR
FT                   ASLGAGAWIAGLALALIAGEAVRATALQAAGLLTLAISVLAGGIAVHSGLFDSLSLVVE
FT                   YRARAGAVNAAILQHLALAAGALALAVAASVPLALLSLRRGFAARLIDTALNGVQVVPA
FT                   LALFAALVSLLSGLLARLPGLRELGLGAIGPTPAVIGTAAYLALPLVRSLAAGLAATDP
FT                   TVVETARALGLTPWQVLLRVRLPLGAPILLGGLRVAAVQSIGLTTLGGLVGAGGLGAVV
FT                   FDGMAQFAPDLIVLGAVPVIALSLAVDRGLAALNPRRVA"
     MTLGARPLPV LAFAAAATAA AALAGLPLLT LAPNRLVPGA PVGAGWAGAG AALLGLLAAG        60
     LLSGTRRRDA LLALAAALTG LAVLGLGIGA GAAGLLAGQP PAARASLGAG AWIAGLALAL       120
     IAGEAVRATA LQAAGLLTLA ISVLAGGIAV HSGLFDSLSL VVEYRARAGA VNAAILQHLA       180
     LAAGALALAV AASVPLALLS LRRGFAARLI DTALNGVQVV PALALFAALV SLLSGLLARL       240
     PGLRELGLGA IGPTPAVIGT AAYLALPLVR SLAAGLAATD PTVVETARAL GLTPWQVLLR       300
     VRLPLGAPIL LGGLRVAAVQ SIGLTTLGGL VGAGGLGAVV FDGMAQFAPD LIVLGAVPVI       360
     ALSLAVDRGL AALNPRRVA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page