(data stored in ACNUC7421 zone)

EMBL: CP001349.PE190

CP001349.PE190       Location/Qualifiers
FT   CDS             217982..220705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0197"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG:
FT                   mrd:Mrad2831_0205 osmosensitive K+ channel signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55242"
FT                   /db_xref="GOA:B8I9I9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I9"
FT                   /inference="protein motif:PFAM:PF02702"
FT                   /protein_id="ACL55242.1"
FT                   /translation="MSEPRRDPTRPSPDALLAAARREEGRRGRLKVFLGAAPGVGKTYE
FT                   MLTIGRARRKAGADVVVGIVETHGRAETEVLLEGFEVIPRRRVPYRGTLLEEMDLDALL
FT                   ARRPALALVDELAHTNAPGSRHPKRYQDVEELLDAGIDVLTTLNIQHVESLNDVVASIT
FT                   RIRVRETVPDSILDRADDIEVVDLNPDDLIQRLKDGKVYVPQNAERALKHYFSRGNLTA
FT                   LRELALRCTADRVDDELLSHMRANAIAGPWGAGERVLVCVGEDPRAAGLVRYAKRLADR
FT                   LHAPWTALTVEGPRSPSLSEAERDRIADTLRLADRLGGDTVTIPGGRRIAEDILAYARS
FT                   ANVNHVVVGKSDRSWLFELMHGSVVHDLVRRSGTISVHVVAGEAAEAAPVPRKTVATMA
FT                   ATPAWGPRPYAVALLAVAAALGVALLGQPYVGVENSNLFLLSSVVAVAVRYGLGPSLLA
FT                   VVAASLSYNFFFLPPVYTFTIADPTNVAAFVLFTVVAVLVSNLAARSQRVAAVAQARAR
FT                   ATERLYGFSRKLASCGTLDDVLWATCAQVAAMLKVRVVLLLPEQDGLAVRAGYPPEDML
FT                   DDADVAAAKWAFDNDRSAGRGADTLPGAKRLFLPMRTGRGTIGVIGLDADGTGPILTPE
FT                   GRRLLDALADQGALAIERVRLVEDLDRAERAAETDRLRQALLTSMSHDLRTPLASVLGA
FT                   ATTLRDLDEALAPEAKRDLLATIIAESERLNRFIANLLDMTRLEAGAVAPNLAPHDIGE
FT                   TVGTALRRTEAMLAGHRVAIDVPADLPALRLDPVLFEQVLVNLLDNAAKYAPEGSTVTI
FT                   RGWREGSLVRLQVLDEGEGLPEAEIERVFDKFYRVRKGDRVRAGTGLGLSIARGFVEAM
FT                   GGALVAANRPDRPGAAFTLTLPVPAKDRDAAPEIAA"
     MSEPRRDPTR PSPDALLAAA RREEGRRGRL KVFLGAAPGV GKTYEMLTIG RARRKAGADV        60
     VVGIVETHGR AETEVLLEGF EVIPRRRVPY RGTLLEEMDL DALLARRPAL ALVDELAHTN       120
     APGSRHPKRY QDVEELLDAG IDVLTTLNIQ HVESLNDVVA SITRIRVRET VPDSILDRAD       180
     DIEVVDLNPD DLIQRLKDGK VYVPQNAERA LKHYFSRGNL TALRELALRC TADRVDDELL       240
     SHMRANAIAG PWGAGERVLV CVGEDPRAAG LVRYAKRLAD RLHAPWTALT VEGPRSPSLS       300
     EAERDRIADT LRLADRLGGD TVTIPGGRRI AEDILAYARS ANVNHVVVGK SDRSWLFELM       360
     HGSVVHDLVR RSGTISVHVV AGEAAEAAPV PRKTVATMAA TPAWGPRPYA VALLAVAAAL       420
     GVALLGQPYV GVENSNLFLL SSVVAVAVRY GLGPSLLAVV AASLSYNFFF LPPVYTFTIA       480
     DPTNVAAFVL FTVVAVLVSN LAARSQRVAA VAQARARATE RLYGFSRKLA SCGTLDDVLW       540
     ATCAQVAAML KVRVVLLLPE QDGLAVRAGY PPEDMLDDAD VAAAKWAFDN DRSAGRGADT       600
     LPGAKRLFLP MRTGRGTIGV IGLDADGTGP ILTPEGRRLL DALADQGALA IERVRLVEDL       660
     DRAERAAETD RLRQALLTSM SHDLRTPLAS VLGAATTLRD LDEALAPEAK RDLLATIIAE       720
     SERLNRFIAN LLDMTRLEAG AVAPNLAPHD IGETVGTALR RTEAMLAGHR VAIDVPADLP       780
     ALRLDPVLFE QVLVNLLDNA AKYAPEGSTV TIRGWREGSL VRLQVLDEGE GLPEAEIERV       840
     FDKFYRVRKG DRVRAGTGLG LSIARGFVEA MGGALVAANR PDRPGAAFTL TLPVPAKDRD       900
     AAPEIAA                                                                 907
//

If you have problems or comments...

PBIL Back to PBIL home page