(data stored in ACNUC7421 zone)

EMBL: CP001349.PE191

CP001349.PE191       Location/Qualifiers
FT   CDS             220702..220893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55243"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55243.1"
FT                   /translation="MSIRILVADGEPPIRRLPRTDLPAPGTRRPQPGATTLTRLKRPPL
FT                   SWMPFGGERSSPSRGPLP"
     MSIRILVADG EPPIRRLPRT DLPAPGTRRP QPGATTLTRL KRPPLSWMPF GGERSSPSRG        60
     PLP                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page