(data stored in ACNUC7421 zone)

EMBL: CP001349.PE192

CP001349.PE192       Location/Qualifiers
FT   CDS             220890..221360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0199"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: mrd:Mrad2831_0203
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55244"
FT                   /db_xref="GOA:B8I9J1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J1"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACL55244.1"
FT                   /translation="MTLEDLLSPDQAVTGLRVGGKDALLEEMARRAGRATGLGMDAILS
FT                   ALVKREALGSTGVGDGVALPHGRLAGLARPFGLLASLRAAIAYEAVDDRPVDLVVLLLL
FT                   PRNAEGADLNALACVARRLRDRRVADAMRAARDAAQLYAAACGAGSLTRSGA"
     MTLEDLLSPD QAVTGLRVGG KDALLEEMAR RAGRATGLGM DAILSALVKR EALGSTGVGD        60
     GVALPHGRLA GLARPFGLLA SLRAAIAYEA VDDRPVDLVV LLLLPRNAEG ADLNALACVA       120
     RRLRDRRVAD AMRAARDAAQ LYAAACGAGS LTRSGA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page