(data stored in ACNUC7421 zone)

EMBL: CP001349.PE193

CP001349.PE193       Location/Qualifiers
FT   CDS             complement(221341..222123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0200"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rle:pRL120704 putative hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55245"
FT                   /db_xref="GOA:B8I9J2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J2"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL55245.1"
FT                   /translation="MPLAPSETEALGWDLAMARRTGQISTNADLRRLSDLDDAEAVLAA
FT                   ALRHLGGAPAGYVLTGTSPPCAKLLCCEHPVVAPLVREGLLEEGGSLHLPGGAIGVGAG
FT                   FAFRLGRPFPDDGEEITEERAAEACVSCHLDLHLLGRRMPNGILLNAWTATADFGLDVA
FT                   RIRGPRVAGWHDGDLREAAVSLRVDGNELARGRGADILGSPIAAVAWLAGYLAERDLCL
FT                   NAGDLVATGSCTGLIQVLPGQTVLAEFGPLGRVTLRIA"
     MPLAPSETEA LGWDLAMARR TGQISTNADL RRLSDLDDAE AVLAAALRHL GGAPAGYVLT        60
     GTSPPCAKLL CCEHPVVAPL VREGLLEEGG SLHLPGGAIG VGAGFAFRLG RPFPDDGEEI       120
     TEERAAEACV SCHLDLHLLG RRMPNGILLN AWTATADFGL DVARIRGPRV AGWHDGDLRE       180
     AAVSLRVDGN ELARGRGADI LGSPIAAVAW LAGYLAERDL CLNAGDLVAT GSCTGLIQVL       240
     PGQTVLAEFG PLGRVTLRIA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page