(data stored in ACNUC7421 zone)

EMBL: CP001349.PE194

CP001349.PE194       Location/Qualifiers
FT   CDS             complement(222484..224025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0201"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: alpha amylase 3 (IC)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55246"
FT                   /db_xref="GOA:B8I9J3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J3"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACL55246.1"
FT                   /translation="MRCRSILIAFIAMLPVALALPRAAHGQAGFDDDRVLLQSFYWESY
FT                   RHGHPVKFPAYGNKRWYRIVAELAPAIRAGRFDLIWLPSPSFSGAHAACMPRECLHSAG
FT                   YNPKEYFDLDNSYGDAAEHASMLTNLLGNGVEPVADLVLNHRDGSQSWGDFRNPDWGPW
FT                   AITRDDEAFTNPASPLFNLPVPQRGAPEEKPVEYARHGGTTYAYGSFRDLDHTNEQVRR
FT                   DIIRYLLQLKSLGYRGWRYDMVHGYHARWIAVYNRASAPTFSVGEYDWDKPDEQRGWVW
FT                   FTAAVPGRLETSSSVFDFMTQFYLKDHKGDSVAQYGTGRGLVGDTTDGQPWKNKAVTFL
FT                   ENHDTGYRTNEDGTPENSHTADSFANGWEVEQGYARILTHPGVPAVYWKHYFDWGPDLS
FT                   AKIRALINARKVAGVHAGSAVHPQDNARSANVYAARVEGRNGDLYVRIGGSDTDWQPSR
FT                   SGYRDYREYARGAGWTVWVGLSGNPAFQEAPLRAPLPIPIYRDPQTIDVPDRLLN"
     MRCRSILIAF IAMLPVALAL PRAAHGQAGF DDDRVLLQSF YWESYRHGHP VKFPAYGNKR        60
     WYRIVAELAP AIRAGRFDLI WLPSPSFSGA HAACMPRECL HSAGYNPKEY FDLDNSYGDA       120
     AEHASMLTNL LGNGVEPVAD LVLNHRDGSQ SWGDFRNPDW GPWAITRDDE AFTNPASPLF       180
     NLPVPQRGAP EEKPVEYARH GGTTYAYGSF RDLDHTNEQV RRDIIRYLLQ LKSLGYRGWR       240
     YDMVHGYHAR WIAVYNRASA PTFSVGEYDW DKPDEQRGWV WFTAAVPGRL ETSSSVFDFM       300
     TQFYLKDHKG DSVAQYGTGR GLVGDTTDGQ PWKNKAVTFL ENHDTGYRTN EDGTPENSHT       360
     ADSFANGWEV EQGYARILTH PGVPAVYWKH YFDWGPDLSA KIRALINARK VAGVHAGSAV       420
     HPQDNARSAN VYAARVEGRN GDLYVRIGGS DTDWQPSRSG YRDYREYARG AGWTVWVGLS       480
     GNPAFQEAPL RAPLPIPIYR DPQTIDVPDR LLN                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page