(data stored in ACNUC7421 zone)

EMBL: CP001349.PE196

CP001349.PE196       Location/Qualifiers
FT   CDS             224742..226736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0203"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   met:M446_3785 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55248"
FT                   /db_xref="GOA:B8I9J5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J5"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACL55248.1"
FT                   /translation="MRRRVGLALLCSAAIAGPAHAGPAESLSFWDLKPGQLRILVASPQ
FT                   VMVTRTASGWEAYCRCPVVLKPNEIPEAMKKAIIAVEDRRFMEHGGVDLVALAAVLRGG
FT                   LSRGGSTIPMQLLKNLVFHDLQGRDLFSKLERKGSEVWHAGTFDGAVGKQELLAAYLNQ
FT                   IEFGGREIVGLYRASRYYFHKEPRDLNLFECALLAGMVQAPARFNPVKETTKERAYERA
FT                   RLVLGLMVQQGKISQAERLRAERVGVRPGLLPEFRIQAQPFTEWIVQTLAPRFVQEGET
FT                   IRFFVTLEPRFQRLAEKQLSDMVGEGTIPAEYEAGAVMMSGDGRVRAMIGSVDWSRRQF
FT                   NAAVKTSVQPGSTAKLPLIVAACEAGLSPQSRVVDRPITATWPANGHLGYKGETTLLEA
FT                   MASSRNAAAVRLTQDLGVRRVAAVSRRLGIEPGPDPDAGFVLGSFSTNVLSMTAAYATV
FT                   ANGGYRVAPTGVLAVVDGRGQVRASFLDPIRTRVIPQNCVAPTRSILREVVRSGTGRSA
FT                   GLGRWAAYGKTGTSTGNADAWFVGWSEGRVLGVWMGRRRDAVGEGLAGKGAPAEYFRRV
FT                   SSSANEMVEYRIAQQRGKAGSRTAGGPDRQKAANPQKAPEHRPVHASLAPRLDGPEAIR
FT                   LNAAPRPPLRPFREAVPWLRDEDEDLSPW"
     MRRRVGLALL CSAAIAGPAH AGPAESLSFW DLKPGQLRIL VASPQVMVTR TASGWEAYCR        60
     CPVVLKPNEI PEAMKKAIIA VEDRRFMEHG GVDLVALAAV LRGGLSRGGS TIPMQLLKNL       120
     VFHDLQGRDL FSKLERKGSE VWHAGTFDGA VGKQELLAAY LNQIEFGGRE IVGLYRASRY       180
     YFHKEPRDLN LFECALLAGM VQAPARFNPV KETTKERAYE RARLVLGLMV QQGKISQAER       240
     LRAERVGVRP GLLPEFRIQA QPFTEWIVQT LAPRFVQEGE TIRFFVTLEP RFQRLAEKQL       300
     SDMVGEGTIP AEYEAGAVMM SGDGRVRAMI GSVDWSRRQF NAAVKTSVQP GSTAKLPLIV       360
     AACEAGLSPQ SRVVDRPITA TWPANGHLGY KGETTLLEAM ASSRNAAAVR LTQDLGVRRV       420
     AAVSRRLGIE PGPDPDAGFV LGSFSTNVLS MTAAYATVAN GGYRVAPTGV LAVVDGRGQV       480
     RASFLDPIRT RVIPQNCVAP TRSILREVVR SGTGRSAGLG RWAAYGKTGT STGNADAWFV       540
     GWSEGRVLGV WMGRRRDAVG EGLAGKGAPA EYFRRVSSSA NEMVEYRIAQ QRGKAGSRTA       600
     GGPDRQKAAN PQKAPEHRPV HASLAPRLDG PEAIRLNAAP RPPLRPFREA VPWLRDEDED       660
     LSPW                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page