(data stored in ACNUC7421 zone)

EMBL: CP001349.PE197

CP001349.PE197       Location/Qualifiers
FT   CDS             227066..227308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_1408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55249"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J6"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_1408"
FT                   /protein_id="ACL55249.1"
FT                   /translation="MTKLFIAKITEAGAPRPLVTVRAAGEGEARLFLEAAYPDADIEAV
FT                   VEPSDWVSDADTGIAAGDIREHPGVAWQAPSSLAD"
     MTKLFIAKIT EAGAPRPLVT VRAAGEGEAR LFLEAAYPDA DIEAVVEPSD WVSDADTGIA        60
     AGDIREHPGV AWQAPSSLAD                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page