(data stored in ACNUC7421 zone)

EMBL: CP001349.PE198

CP001349.PE198       Location/Qualifiers
FT   CDS             227335..228603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55250"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J7"
FT                   /inference="similar to AA sequence:KEGG:M446_3789"
FT                   /protein_id="ACL55250.1"
FT                   /translation="MAIARARRLRRSAAWILSLLARPARRAQVTQGVAVEAYRGYGSAE
FT                   EIFLIGRVFRQSGTERDADPDDLRAQLRDIGRRIRRRRLADVGVTACFGGSAVRVATDG
FT                   DGYFRIHLRPREPPRSEGAWHPVEITLDADPPVHAQGEVFIPPERCRFVVISDIDDTVM
FT                   HTGVANKLKMLWRLFVADAASRVAFPGVAALYRALHAGPAGAERNPMLYVSRAPWGIYD
FT                   MLSEFFRLHAIPVGPVLFLREWGLSWRHPLPRRAEEHKRDLIGHMLTLYHDLPFVLIGD
FT                   SGQHDPEVYARIVSENPGRVLAVYIRNVSREASRAAEIEQLAKTVAAAGSSLVLAADSR
FT                   AIAEHAARLGLIAAQAVEDVASEKVAAEGAGRRSPLRRISRSTPDATAAAVTGGELDAA
FT                   LDDSSPDPPNVIVEPAHRGHTGS"
     MAIARARRLR RSAAWILSLL ARPARRAQVT QGVAVEAYRG YGSAEEIFLI GRVFRQSGTE        60
     RDADPDDLRA QLRDIGRRIR RRRLADVGVT ACFGGSAVRV ATDGDGYFRI HLRPREPPRS       120
     EGAWHPVEIT LDADPPVHAQ GEVFIPPERC RFVVISDIDD TVMHTGVANK LKMLWRLFVA       180
     DAASRVAFPG VAALYRALHA GPAGAERNPM LYVSRAPWGI YDMLSEFFRL HAIPVGPVLF       240
     LREWGLSWRH PLPRRAEEHK RDLIGHMLTL YHDLPFVLIG DSGQHDPEVY ARIVSENPGR       300
     VLAVYIRNVS REASRAAEIE QLAKTVAAAG SSLVLAADSR AIAEHAARLG LIAAQAVEDV       360
     ASEKVAAEGA GRRSPLRRIS RSTPDATAAA VTGGELDAAL DDSSPDPPNV IVEPAHRGHT       420
     GS                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page