(data stored in ACNUC7421 zone)

EMBL: CP001349.PE199

CP001349.PE199       Location/Qualifiers
FT   CDS             complement(229118..230911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0206"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: met:M446_3141
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55251"
FT                   /db_xref="GOA:B8I9J8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J8"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ACL55251.1"
FT                   /translation="MTALIDHPRPLLDVHRSVLGRPWRDRCAEAGPQAAAVTIAQSHGL
FT                   PEVLARVLAGRGVAPGEVPGFLEPRLRDLMPDPSILVDMEAAADRLAHAVLRREKVAIF
FT                   GDYDVDGAASAALLAGTLRDLGVPFRLHIPDRITEGYGPNGEAIRMLAGEGASLLVTVD
FT                   CGTAGHGPLAEAARLGLDVLVLDHHGAPETLPPARAVVNPNRLDDLSGLGHLCAAGVVF
FT                   LTLVALKRRLRRDGVEVPDLMAGLDLVALATVADVVPLLGLNRAFVRQGLAVMRGRGRR
FT                   GLAALLDAAGLAEPPQAWHLGFLVGPRINAGGRIGDATLGARLLLCEDPIEAAGIAAQL
FT                   DQLNRERQAIEAAAVAEAEALAALRLERDPDQPVIVAGSPDWHPGVVGLIAARLKERFG
FT                   RPAFAFALREDGTATGSGRSIIGADLGRAVRRAVEAGLAAKGGGHAMAAGVTLAAVDLD
FT                   RFRDGLSQELAAAVGDARAAQALLVDGVLSAGGVQPDLVAAVERAGPFGQGAPEPVFAL
FT                   ARHRIADARIVGTGHVKAQLRGRDGVTVGAIAFRAAEGPLGQLLLRSIGRDIHAAGTLS
FT                   RDRWRGGERVQLRLCDAAETV"
     MTALIDHPRP LLDVHRSVLG RPWRDRCAEA GPQAAAVTIA QSHGLPEVLA RVLAGRGVAP        60
     GEVPGFLEPR LRDLMPDPSI LVDMEAAADR LAHAVLRREK VAIFGDYDVD GAASAALLAG       120
     TLRDLGVPFR LHIPDRITEG YGPNGEAIRM LAGEGASLLV TVDCGTAGHG PLAEAARLGL       180
     DVLVLDHHGA PETLPPARAV VNPNRLDDLS GLGHLCAAGV VFLTLVALKR RLRRDGVEVP       240
     DLMAGLDLVA LATVADVVPL LGLNRAFVRQ GLAVMRGRGR RGLAALLDAA GLAEPPQAWH       300
     LGFLVGPRIN AGGRIGDATL GARLLLCEDP IEAAGIAAQL DQLNRERQAI EAAAVAEAEA       360
     LAALRLERDP DQPVIVAGSP DWHPGVVGLI AARLKERFGR PAFAFALRED GTATGSGRSI       420
     IGADLGRAVR RAVEAGLAAK GGGHAMAAGV TLAAVDLDRF RDGLSQELAA AVGDARAAQA       480
     LLVDGVLSAG GVQPDLVAAV ERAGPFGQGA PEPVFALARH RIADARIVGT GHVKAQLRGR       540
     DGVTVGAIAF RAAEGPLGQL LLRSIGRDIH AAGTLSRDRW RGGERVQLRL CDAAETV          597
//

If you have problems or comments...

PBIL Back to PBIL home page