(data stored in ACNUC7421 zone)

EMBL: CP001349.PE2

CP001349.PE2         Location/Qualifiers
FT   CDS             1663..2784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: met:M446_0002 DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55054"
FT                   /db_xref="GOA:B8ISZ2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ2"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACL55054.1"
FT                   /translation="MRVTVERAALLRSLGHVHRVVERRNTIPILSNVLLRSSADGLQLK
FT                   ATDLDIEVTETIPADVADGGATTVPAHVIYDIVRKLPEGAQVSLETTGDTGQMLIRSGR
FT                   SRFTLGALPETDFPDLAAGELPHRFQLQAAELKKLIDKTQFAISTEETRYYLNGIFFHT
FT                   IEAEGGVKLRAVATDGHRLARVEMPAPEGSHGMPGIIVPRKAVAEIQKLVEDGGDSVGV
FT                   EISSAKVRFTFSTGVMLISKLIDGTFPDYQRVIPTGNDKLLTVERDQFAKAVDRVSTIS
FT                   SERGRAVKLAVAGGRLSLSVNNPDSGSATEELDADYEAAPLDIGFNARYLLDITAQLDG
FT                   DTALFKLADPGSPTLIQDKDGAPALYVLMPMRV"
     MRVTVERAAL LRSLGHVHRV VERRNTIPIL SNVLLRSSAD GLQLKATDLD IEVTETIPAD        60
     VADGGATTVP AHVIYDIVRK LPEGAQVSLE TTGDTGQMLI RSGRSRFTLG ALPETDFPDL       120
     AAGELPHRFQ LQAAELKKLI DKTQFAISTE ETRYYLNGIF FHTIEAEGGV KLRAVATDGH       180
     RLARVEMPAP EGSHGMPGII VPRKAVAEIQ KLVEDGGDSV GVEISSAKVR FTFSTGVMLI       240
     SKLIDGTFPD YQRVIPTGND KLLTVERDQF AKAVDRVSTI SSERGRAVKL AVAGGRLSLS       300
     VNNPDSGSAT EELDADYEAA PLDIGFNARY LLDITAQLDG DTALFKLADP GSPTLIQDKD       360
     GAPALYVLMP MRV                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page