(data stored in ACNUC7421 zone)

EMBL: CP001349.PE20

CP001349.PE20        Location/Qualifiers
FT   CDS             complement(22760..23692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0021"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: met:M446_0018
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55072"
FT                   /db_xref="GOA:B8IT10"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT10"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACL55072.1"
FT                   /translation="MNPPSPTSRALCTLSRRKLILGASAAALTGSAARAAETPVTVASK
FT                   GDAEGTLLGQMILQTLRRIDIPVVDRLQLGPTRIVRTALVAGEIDAYPEYTGNVAFFSG
FT                   TETDPAWKRAETAYAAARRFDASRGLVWLTPARANNSWQIAVRGGLARAEGLSSMEDFA
FT                   RAVRRGLIEFAASAEFVESPAALAAYEQAYGFVLPRERIVTLPGGDTSVTLRAAAQGIS
FT                   GVNAGMVYGTDGAITALDVVVMADPKGAQIVYEPAPVFREPVLARHPAIAPALDRVFAG
FT                   LDLPTLRRLNAAITVEGETPEAVARRHLG"
     MNPPSPTSRA LCTLSRRKLI LGASAAALTG SAARAAETPV TVASKGDAEG TLLGQMILQT        60
     LRRIDIPVVD RLQLGPTRIV RTALVAGEID AYPEYTGNVA FFSGTETDPA WKRAETAYAA       120
     ARRFDASRGL VWLTPARANN SWQIAVRGGL ARAEGLSSME DFARAVRRGL IEFAASAEFV       180
     ESPAALAAYE QAYGFVLPRE RIVTLPGGDT SVTLRAAAQG ISGVNAGMVY GTDGAITALD       240
     VVVMADPKGA QIVYEPAPVF REPVLARHPA IAPALDRVFA GLDLPTLRRL NAAITVEGET       300
     PEAVARRHLG                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page