(data stored in ACNUC7421 zone)

EMBL: CP001349.PE200

CP001349.PE200       Location/Qualifiers
FT   CDS             complement(231185..232582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0207"
FT                   /product="NAD(P) transhydrogenase beta subunit"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   met:M446_3142 NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55252"
FT                   /db_xref="GOA:B8I9J9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J9"
FT                   /inference="protein motif:PFAM:PF02233"
FT                   /protein_id="ACL55252.1"
FT                   /translation="MSENISSLLYIVAGVLFIMALRGLSHPTTSRQGNLYGMVGMGIAI
FT                   LTTLVGHAPAGAGAWLLVLLGLGIGGGVGAVIARRVPMTAMPQLVAAFHSLVGLAAVAV
FT                   AAGALYAPHAFGILEGGHIHKQSLFEMGLGVAIGAITFTGSVIAFLKLDGRMSGKPIML
FT                   PQRHLINILLGVLLVVLLATFIANESKVLFWLIVLLSFALGGLLIIPIGGADMPVVVSM
FT                   LNSYSGWAAAGIGFTLGNLALIITGSLVGSSGAILSYIMCHAMNRSFISVILGGFGGES
FT                   AVAAGGQVEARPVKQGSADDAAFIMKNAEKVIIVPGYGMAVAQAQHSLREMADQLKKEG
FT                   VEVKYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEDINGEFPQADVAFVIGANDVTNP
FT                   AAKTDPQSPIFGMPILDVEKAKTVLFVKRGMGSGYAGVENEVFFRDNTMMLFGDAKKVV
FT                   DEIVKSF"
     MSENISSLLY IVAGVLFIMA LRGLSHPTTS RQGNLYGMVG MGIAILTTLV GHAPAGAGAW        60
     LLVLLGLGIG GGVGAVIARR VPMTAMPQLV AAFHSLVGLA AVAVAAGALY APHAFGILEG       120
     GHIHKQSLFE MGLGVAIGAI TFTGSVIAFL KLDGRMSGKP IMLPQRHLIN ILLGVLLVVL       180
     LATFIANESK VLFWLIVLLS FALGGLLIIP IGGADMPVVV SMLNSYSGWA AAGIGFTLGN       240
     LALIITGSLV GSSGAILSYI MCHAMNRSFI SVILGGFGGE SAVAAGGQVE ARPVKQGSAD       300
     DAAFIMKNAE KVIIVPGYGM AVAQAQHSLR EMADQLKKEG VEVKYAIHPV AGRMPGHMNV       360
     LLAEANVPYD EVFELEDING EFPQADVAFV IGANDVTNPA AKTDPQSPIF GMPILDVEKA       420
     KTVLFVKRGM GSGYAGVENE VFFRDNTMML FGDAKKVVDE IVKSF                       465
//

If you have problems or comments...

PBIL Back to PBIL home page