(data stored in ACNUC7421 zone)

EMBL: CP001349.PE201

CP001349.PE201       Location/Qualifiers
FT   CDS             complement(232587..233036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0208"
FT                   /product="PntAB, NAD(P) transhydrogenase, alpha2 subunit"
FT                   /note="KEGG: met:M446_3143 PntAB, NAD(P) transhydrogenase,
FT                   alpha2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55253"
FT                   /db_xref="GOA:B8I9K0"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K0"
FT                   /inference="similar to AA sequence:KEGG:M446_3143"
FT                   /protein_id="ACL55253.1"
FT                   /translation="MATLPPDQAAEQARAAAAAARTAADIAAKAAEQAQAIADAAGHGI
FT                   AAVTHGAVDPTVFRLAIFVLAIFVGYYVVWSVTPALHTPLMSVTNAISSVIVVGALLAV
FT                   GVPLVEKGTGIARFLGFLGLVFASVNIFGGFLVTQRMLGMYKKKA"
     MATLPPDQAA EQARAAAAAA RTAADIAAKA AEQAQAIADA AGHGIAAVTH GAVDPTVFRL        60
     AIFVLAIFVG YYVVWSVTPA LHTPLMSVTN AISSVIVVGA LLAVGVPLVE KGTGIARFLG       120
     FLGLVFASVN IFGGFLVTQR MLGMYKKKA                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page