(data stored in ACNUC7421 zone)

EMBL: CP001349.PE202

CP001349.PE202       Location/Qualifiers
FT   CDS             complement(233054..234193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0209"
FT                   /product="alanine dehydrogenase/PNT domain protein"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: met:M446_3144 NAD(P)(+) transhydrogenase
FT                   (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55254"
FT                   /db_xref="GOA:B8I9K1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K1"
FT                   /inference="protein motif:PFAM:PF01262"
FT                   /protein_id="ACL55254.1"
FT                   /translation="MRIAVLSETDPAEPRVAAIPETVKKYKSLGADVTVQSGAGAKAGL
FT                   PDSEFEAVGATIAPDAAAAAKDAEIVLRVRRPAAEELPGLKRGAIVVGIMDPYGHEAEI
FT                   KALADAGVAAIAMELMPRITRAQVMDVLSSQANLAGYRAVVDGAAVYGRALPMMMTAAG
FT                   TVPAARVFVMGAGVAGLQAIATARRLGAVVTATDVRPAAKEQVESLGAKFIAVEDEEFK
FT                   QAETAGGYAKEMSAEYRRKQAELVASHIAKQDIVITTALIPGRPAPRLVTAEMIAAMRP
FT                   GSVLVDLAVERGGNVEGAKADEIVETPNGVKIVAYANVPGRLAATSSSLYARNLYAFVE
FT                   TLIDKASKSLAVKWDDELVKATCLTRDGAVIHPNFQPNA"
     MRIAVLSETD PAEPRVAAIP ETVKKYKSLG ADVTVQSGAG AKAGLPDSEF EAVGATIAPD        60
     AAAAAKDAEI VLRVRRPAAE ELPGLKRGAI VVGIMDPYGH EAEIKALADA GVAAIAMELM       120
     PRITRAQVMD VLSSQANLAG YRAVVDGAAV YGRALPMMMT AAGTVPAARV FVMGAGVAGL       180
     QAIATARRLG AVVTATDVRP AAKEQVESLG AKFIAVEDEE FKQAETAGGY AKEMSAEYRR       240
     KQAELVASHI AKQDIVITTA LIPGRPAPRL VTAEMIAAMR PGSVLVDLAV ERGGNVEGAK       300
     ADEIVETPNG VKIVAYANVP GRLAATSSSL YARNLYAFVE TLIDKASKSL AVKWDDELVK       360
     ATCLTRDGAV IHPNFQPNA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page