(data stored in ACNUC7421 zone)

EMBL: CP001349.PE203

CP001349.PE203       Location/Qualifiers
FT   CDS             complement(234413..234706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55255"
FT                   /db_xref="GOA:B8I9K2"
FT                   /db_xref="InterPro:IPR012422"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K2"
FT                   /inference="similar to AA sequence:KEGG:M446_3145"
FT                   /protein_id="ACL55255.1"
FT                   /translation="MASSNHASNDAYGPSMDGDTHEATYRGFVRFVEIATTVVVCWILS
FT                   LGIGGIREAWLTAIFGVVLSGLAGAVGALAPALGWRAPGAVAVLLAVLLALY"
     MASSNHASND AYGPSMDGDT HEATYRGFVR FVEIATTVVV CWILSLGIGG IREAWLTAIF        60
     GVVLSGLAGA VGALAPALGW RAPGAVAVLL AVLLALY                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page