(data stored in ACNUC7421 zone)

EMBL: CP001349.PE204

CP001349.PE204       Location/Qualifiers
FT   CDS             complement(234853..236214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0211"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: met:M446_3146
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55256"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K3"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ACL55256.1"
FT                   /translation="MSDTEANRFSARAARYARVGANMGGVAARMAGSRLLGRKGEELSN
FT                   AAALAQALGGLKGPIMKVAQLLATVPDLLPPEYAQELQKLQSEAPPMGAAFVKRRMAAE
FT                   LGADWQSRFGSFDLKPSAAASLGQVHRAATRDGAPLACKLQYPDMQSAVEADLKQLEFA
FT                   FALHRRMRIAIDTREIAKEIGDRVREELDYLREAKHAALYSEVLRDIATVRVPGVHPGL
FT                   TTKRLLTLDWLEGEKILTFAQAPLEIRNRLAHAMFKAWWHPFSRAAVIHGDPHLGNYTV
FT                   FSEGGEPQGINLLDYGCIRIFHPRFVGGVVDLYRGLLHDDQERIVHAYESWGFRRLNRE
FT                   LIDILNIWARFIYGPLLEDRVRTVADGVKPGEYGRRQAFEVHRALKERGPVTVPREFVF
FT                   MDRAAVGLGAVFLHLRSELNYHRLFEAEIDRFSLDELAARQKMALEAAKLPLPA"
     MSDTEANRFS ARAARYARVG ANMGGVAARM AGSRLLGRKG EELSNAAALA QALGGLKGPI        60
     MKVAQLLATV PDLLPPEYAQ ELQKLQSEAP PMGAAFVKRR MAAELGADWQ SRFGSFDLKP       120
     SAAASLGQVH RAATRDGAPL ACKLQYPDMQ SAVEADLKQL EFAFALHRRM RIAIDTREIA       180
     KEIGDRVREE LDYLREAKHA ALYSEVLRDI ATVRVPGVHP GLTTKRLLTL DWLEGEKILT       240
     FAQAPLEIRN RLAHAMFKAW WHPFSRAAVI HGDPHLGNYT VFSEGGEPQG INLLDYGCIR       300
     IFHPRFVGGV VDLYRGLLHD DQERIVHAYE SWGFRRLNRE LIDILNIWAR FIYGPLLEDR       360
     VRTVADGVKP GEYGRRQAFE VHRALKERGP VTVPREFVFM DRAAVGLGAV FLHLRSELNY       420
     HRLFEAEIDR FSLDELAARQ KMALEAAKLP LPA                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page